LL-37

LL-37

$64.00

Full Name: Cathelicidin LL-37
Alternative Names: LL37, Ropocamptide, Cathelicidin Antimicrobial Peptide
CAS #: 154947-66-7
Molecular Formula: C₂₀₅H₃₄₀N₆₀O₅₃
Molecular Weight (M.W.): Approximately 4493 g/mol
Sequence: Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
One-Letter Sequence: [LL-37, 37 aa]
Length: 37 amino-acid residues
Product Type: Synthetic Research Peptide

LL-37 is a 37-residue peptide corresponding to the mature human cathelicidin sequence. It is supplied for controlled laboratory, biochemical, analytical, and scientific research.

Its defined linear sequence and molecular composition make it suitable for peptide characterization, molecular interaction studies, structure-function analysis, and controlled non-clinical biochemical research.

PubChem identifies LL-37 with molecular formula C₂₀₅H₃₄₀N₆₀O₅₃, molecular weight approximately 4493 g/mol, and sequence [LL-37, 37 aa]

Research Applications

LL-37 may be examined in controlled non-clinical research involving:

  • Peptide identity and characterization
  • Molecular interaction studies
  • Innate-defense pathway research
  • Protein and membrane interaction studies
  • Structure-function analysis
  • Analytical peptide comparison
  • Stability assessment
  • Non-clinical biochemical and cellular models

Any experimental observations should remain limited to the applicable research system and should not be interpreted as evidence of antimicrobial treatment efficacy, wound-healing benefit, immune benefit, therapeutic effectiveness, or suitability for human use.

Structural Information

LL-37 consists of 37 amino-acid residues:

[LL-37, 37 aa]

Expanded representation:

H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH

PubChem lists LL-37 as a linear peptide with free N- and C-terminal ends in the parent record.

Analytical Identification

Relevant analytical characterization may include:

  • Amino-acid sequence confirmation
  • Molecular mass assessment
  • Chromatographic purity testing
  • Peptide identity verification
  • Structural characterization
  • Lot-specific quality testing

If the supplied material is present as a TFA, acetate, or another counter-ion form, molecular specifications should be matched to that exact preparation.

Specifications & Documentation

Lot-specific documentation should be reviewed for:

  • Compound identity
  • Amino-acid sequence
  • Molecular formula
  • Molecular weight
  • Terminal state
  • Salt or counter-ion form
  • Purity specification
  • Analytical testing
  • Lot or batch information
  • Certificate of Analysis
  • Storage requirements

Authenticated lot-specific analytical documentation should take precedence over generalized database values.

Storage & Handling

Store according to the conditions specified on the product label and Certificate of Analysis. Protect the material from environmental conditions that could compromise peptide integrity.

Handling should follow established laboratory procedures appropriate for research materials.

Research Use Only

LL-37 is supplied exclusively for laboratory research, analytical testing, and scientific reference purposes.

Disclaimer

For research use only. Not for human or veterinary use. Not intended for consumption, administration, antimicrobial treatment, wound-care use, immune-related use, diagnosis, treatment, mitigation, cure, or prevention of any disease. No therapeutic, antimicrobial-treatment, regenerative, immune-related, medical, or clinical claims are made or implied. Product information is supplied solely for scientific identification, documentation, and research reference.

RELATED PRODUCTS