PNC-27 is a synthetic 32-residue chimeric peptide supplied for controlled laboratory, analytical, and scientific research.
Its structure combines a p53-derived peptide segment with a membrane-associated peptide sequence in a single covalent chain. This defined sequence gives PNC-27 a distinct molecular identity that can be characterized using sequence analysis, molecular mass assessment, chromatographic testing, and other analytical methods.
Current chemical references identify PNC-27 with CAS 1159861-00-3, molecular formula C₁₈₈H₂₉₃N₅₃O₄₄S, and molecular weight approximately 4031.7 g/mol.
Research Applications
PNC-27 may be examined in controlled non-clinical research involving:
- Chimeric peptide characterization
- Protein-peptide interaction studies
- Membrane-associated biochemical research
- Structure-function analysis
- Analytical peptide comparison
- Molecular binding studies
- Stability assessment
- Non-clinical cellular models
Published research involving PNC-27 is preclinical and should not be interpreted as evidence of therapeutic effectiveness, anticancer treatment efficacy, clinical safety, or suitability for human use.
Structural Information
PNC-27 consists of 32 amino-acid residues:
PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
Expanded representation:
Pro-Pro-Leu-Ser-Gln-Glu-Thr-Phe-Ser-Asp-Leu-Trp-Lys-Leu-Leu-Lys-Lys-Trp-Lys-Met-Arg-Arg-Asn-Gln-Phe-Trp-Val-Lys-Val-Gln-Arg-Gly
The sequence incorporates a p53-derived region and a second peptide segment within one continuous chain. Current reference sources identify the sequence above consistently with the CAS and molecular specifications listed for PNC-27.
Analytical Identification
Relevant analytical characterization may include:
- Amino-acid sequence confirmation
- Molecular mass assessment
- Chromatographic purity testing
- Peptide identity verification
- Structural characterization
- LC-MS analysis
- Lot-specific quality testing
If the supplied material contains a defined salt or counter-ion, final molecular specifications should be matched to that exact preparation.
Specifications & Documentation
Lot-specific documentation should be reviewed for:
- Compound identity
- Amino-acid sequence
- Molecular formula
- Molecular weight
- Salt or counter-ion form
- Purity specification
- Analytical testing
- Lot or batch information
- Certificate of Analysis
- Storage requirements
Authenticated lot-specific documentation should take precedence over generalized supplier information.
Storage & Handling
Store according to the conditions specified on the product label and Certificate of Analysis. Protect the material from moisture and environmental conditions that could compromise peptide integrity.
Handling should follow established laboratory procedures appropriate for research peptide materials.
Research Use Only
PNC-27 is supplied exclusively for laboratory research, analytical testing, and scientific reference purposes.
Disclaimer
For research use only. Not for human or veterinary use. Not intended for consumption, administration, cancer treatment, diagnostic use, therapeutic use, mitigation, cure, or prevention of any disease. No anticancer, therapeutic, medical, or clinical claims are made or implied. Product information is supplied solely for scientific identification, documentation, and research reference.
