CJC-1295 No DAC is a modified 29-residue synthetic peptide supplied for controlled laboratory and analytical research. It is commonly associated with Modified GRF (1-29) and lacks the Drug Affinity Complex modification present in the DAC-containing form.
This structural distinction changes its molecular identity and makes it important to document CJC-1295 No DAC separately from CJC-1295 DAC.
Its defined peptide backbone and terminal modification support research involving peptide identification, structural characterization, receptor-associated biochemical systems, molecular interactions, and comparative analytical studies.
Research Applications
CJC-1295 No DAC may be examined in controlled non-clinical research involving:
- Peptide identity and characterization
- Ligand-receptor interaction studies
- Molecular signaling research
- Structure-function analysis
- Analytical peptide comparison
- Stability assessment
- Non-clinical biochemical and cellular models
Any experimental findings should remain limited to the applicable research system and should not be interpreted as evidence of therapeutic effectiveness, hormonal benefit, performance enhancement, or suitability for human use.
Structural Information
CJC-1295 No DAC is commonly represented as:
Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH₂
One-letter representation:
YADAIFTQSYRKVLAQLSARKLLQDILSR-NH₂
The D-alanine substitution and C-terminal amidation form part of the defined molecular identity.
Analytical Identification
Relevant analytical characterization may include:
- Amino-acid sequence confirmation
- Molecular mass assessment
- C-terminal amidation verification
- Modified-residue verification
- Chromatographic purity testing
- Structural characterization
- Lot-specific quality analysis
Care should be taken to distinguish the no-DAC form from CJC-1295 DAC during analytical review and product documentation.
Specifications & Documentation
Lot-specific documentation should be reviewed for:
- Compound identity
- Peptide sequence
- Molecular formula
- Molecular weight
- Absence of DAC modification
- Salt or counter-ion form
- Purity specification
- Analytical testing
- Lot or batch information
- Certificate of Analysis
- Storage requirements
Authenticated product-specific documentation should take precedence over generalized database or vendor nomenclature.
Storage & Handling
Store according to the conditions stated on the product label and Certificate of Analysis. Protect the material from environmental conditions that could compromise peptide integrity.
Handling should follow established laboratory procedures appropriate for research materials.
Research Use Only
CJC-1295 No DAC is supplied exclusively for laboratory research, analytical testing, and scientific reference purposes.
Disclaimer
For research use only. Not for human or veterinary use. Not intended for consumption, administration, hormonal use, performance enhancement, diagnosis, treatment, mitigation, cure, or prevention of any disease. No therapeutic, hormonal, medical, or clinical claims are made or implied. Product information is supplied solely for scientific identification, documentation, and research reference.
