CJC-1295 No DAC 5mg + IPA 5mg

CJC-1295 No DAC 5mg + IPA 5mg

$47.00

Product Type: Multi-Component Research Peptide Blend
Blend Ratio: 5 mg CJC-1295 No DAC + 5 mg Ipamorelin
Total Peptide Content: 10 mg
Blend CAS #: Not Applicable
Blend Molecular Formula: Not Applicable
Blend Molecular Weight (M.W.): Not Applicable
Blend Sequence: Not Applicable

CJC-1295 No DAC

Alternative Name: Modified GRF (1-29)
CAS #: Commonly referenced as 863288-34-0; verify against lot-specific COA
Molecular Formula: C₁₅₂H₂₅₂N₄₄O₄₂
Molecular Weight (M.W.): Approximately 3367.9 g/mol
Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH₂
One-Letter Sequence: YADAIFTQSYRKVLAQLSARKLLQDILSR-NH₂

Ipamorelin

Alternative Name: NNC-26-0161
CAS #: 170851-70-4
Molecular Formula: C₃₈H₄₉N₉O₅
Molecular Weight (M.W.): Approximately 711.85 g/mol
Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH₂
Length: 5 residues

CJC-1295 No DAC 5 mg + Ipamorelin 5 mg is a two-component research peptide blend containing equal nominal quantities of CJC-1295 No DAC and Ipamorelin.

Each component is a chemically distinct peptide with its own molecular identity, structural features, molecular weight, and analytical profile. Because the formulation is a blend rather than a single defined molecule, it should not be assigned one CAS Registry Number, molecular formula, molecular weight, or amino-acid sequence.

The stated 5 mg + 5 mg composition should be confirmed against the product label and lot-specific Certificate of Analysis.

Research Applications

This blend may be examined in controlled non-clinical research involving:

  • Multi-component peptide characterization
  • Ligand-receptor interaction studies
  • Molecular signaling research
  • Comparative peptide analysis
  • Structure-function studies
  • Analytical characterization
  • Stability assessment
  • Non-clinical biochemical and cellular models

Research findings associated with either component individually should not automatically be attributed to the combined formulation.

Analytical Identification

Analytical documentation should distinguish both components independently.

Relevant characterization may include:

  • CJC-1295 No DAC identity
  • Ipamorelin identity
  • Confirmation of the 5 mg + 5 mg composition
  • Molecular mass analysis
  • Chromatographic purity testing
  • Sequence or structural verification
  • Lot and batch information
  • Certificate of Analysis

Specifications & Documentation

Lot-specific documentation should be reviewed for:

  • Exact identity of both components
  • Confirmed 5 mg CJC-1295 No DAC content
  • Confirmed 5 mg Ipamorelin content
  • Molecular forms
  • Salt or counter-ion status
  • Purity specifications
  • Analytical testing
  • Lot or batch identification
  • Certificate of Analysis
  • Storage requirements

Authenticated product-specific documentation should take precedence over generalized reference information.

Storage & Handling

Store according to the conditions specified on the product label and Certificate of Analysis. Protect the formulation from environmental conditions that could compromise peptide integrity.

Handling should follow established laboratory procedures appropriate for multi-component research materials.

Research Use Only

CJC-1295 No DAC 5 mg + Ipamorelin 5 mg is supplied exclusively for laboratory research, analytical testing, and scientific reference purposes.

Disclaimer

For research use only. Not for human or veterinary use. Not intended for consumption, administration, hormonal use, performance enhancement, diagnosis, treatment, mitigation, cure, or prevention of any disease. No therapeutic, hormonal, medical, or clinical claims are made or implied. Product information is supplied solely for scientific identification, documentation, and research reference.

RELATED PRODUCTS