GLP-1, or Glucagon-Like Peptide-1, is a defined peptide supplied for controlled laboratory, analytical, and scientific research.
The GLP-1 designation can refer to several naturally occurring molecular forms. For this product description, the referenced material is GLP-1(7-36) amide, a 30-residue peptide with a C-terminal amide.
Its defined sequence and molecular composition support controlled studies involving peptide identity, molecular interactions, receptor-associated biochemical systems, structural analysis, and comparative peptide characterization.
Research Applications
GLP-1 may be examined in controlled non-clinical research involving:
- Peptide identity and characterization
- Ligand-receptor interaction studies
- Molecular signaling research
- Structure-function analysis
- Comparative peptide studies
- Analytical characterization
- Stability assessment
- Non-clinical biochemical and cellular models
Experimental observations should remain specific to the applicable research system and should not be interpreted as evidence of therapeutic effectiveness, weight-management benefit, metabolic benefit, or suitability for human use.
Structural Information
GLP-1(7-36) amide is represented by the sequence:
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH₂
One-letter representation:
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂
The C-terminal amidation forms part of the defined molecular identity.
Analytical Identification
Relevant characterization may include:
- Amino-acid sequence confirmation
- Molecular mass assessment
- C-terminal amidation verification
- Chromatographic purity testing
- Peptide identity analysis
- Structural characterization
- Lot-specific quality testing
Specifications & Documentation
Lot-specific documentation should be reviewed for:
- Exact GLP-1 molecular form
- Amino-acid sequence
- Molecular formula
- Molecular weight
- Terminal modifications
- Salt or counter-ion form
- Purity specification
- Analytical testing
- Lot or batch information
- Certificate of Analysis
- Storage requirements
Authenticated lot-specific documentation should take precedence over generalized reference information.
Storage & Handling
Store according to the conditions specified on the product label and Certificate of Analysis. Protect the material from environmental conditions that could compromise peptide integrity.
Handling should follow established laboratory procedures appropriate for research materials.
Research Use Only
GLP-1 is supplied exclusively for laboratory research, analytical testing, and scientific reference purposes.
Disclaimer
For research use only. Not for human or veterinary use. Not intended for consumption, administration, weight-management use, metabolic use, diagnosis, treatment, mitigation, cure, or prevention of any disease. No therapeutic, metabolic, weight-related, medical, or clinical claims are made or implied. Product information is supplied solely for scientific identification, documentation, and research reference.
