FOXO4-DRI is a synthetic D-retro-inverso research peptide supplied for controlled laboratory and analytical studies. Its structure is based on a sequence associated with the FOXO4 protein interaction domain but uses D-configured residues arranged in a retro-inverso design.
This structural strategy makes FOXO4-DRI chemically and stereochemically distinct from a conventional L-amino-acid peptide. Accurate technical documentation should therefore preserve the D-residue configuration rather than relying only on a simplified one-letter sequence.
PubChem currently lists a FOXO4-DRI TFA salt form with molecular formula C₂₂₈H₃₈₈N₈₆O₆₄, molecular weight approximately 5358 g/mol, and CAS 2460055-10-9.
Research Applications
FOXO4-DRI may be examined in controlled non-clinical research involving:
- D-retro-inverso peptide characterization
- Protein-protein interaction studies
- Molecular binding research
- Structure-function analysis
- Stereochemistry-focused peptide studies
- Analytical peptide comparison
- Stability assessment
- Non-clinical biochemical and cellular models
Any experimental observations should remain limited to the applicable research system and should not be interpreted as evidence of anti-aging, senolytic, therapeutic, regenerative, or clinical effectiveness.
Structural Information
FOXO4-DRI is not a conventional all-L peptide. PubChem represents the sequence with multiple D-configured residues and provides the condensed sequence:
LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG
However, the stereochemical D-residue assignments are essential to the molecular identity and should be preserved in technical records.
Because the product may be supplied as a TFA salt or another defined form, the exact molecular formula and molecular weight should be matched to the lot-specific Certificate of Analysis.
Analytical Identification
Relevant analytical characterization may include:
- Peptide identity confirmation
- Stereochemical verification
- Molecular mass assessment
- Chromatographic purity testing
- Structural characterization
- Salt/counter-ion verification
- Lot-specific quality analysis
Specifications & Documentation
Lot-specific documentation should be reviewed for:
- Compound identity
- Full stereochemical sequence
- Molecular formula
- Molecular weight
- Salt or counter-ion form
- Purity specification
- Analytical testing
- Lot or batch information
- Certificate of Analysis
- Storage requirements
Authenticated product-specific analytical documentation should take precedence over generalized vendor information.
Storage & Handling
Store according to the conditions specified on the product label and Certificate of Analysis. Protect the material from environmental conditions that could compromise peptide integrity.
Handling should follow established laboratory procedures appropriate for modified research peptides.
Research Use Only
FOXO4-DRI is supplied exclusively for laboratory research, analytical testing, and scientific reference purposes.
Disclaimer
For research use only. Not for human or veterinary use. Not intended for consumption, administration, anti-aging or senolytic use, diagnosis, treatment, mitigation, cure, or prevention of any disease. No therapeutic, anti-aging, regenerative, senolytic, medical, or clinical claims are made or implied. Product information is supplied solely for scientific identification, documentation, and research reference.
